FBXO42 polyclonal antibody (A01) View larger

FBXO42 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO42 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FBXO42 polyclonal antibody (A01)

Brand: Abnova
Reference: H00054455-A01
Product name: FBXO42 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant FBXO42.
Gene id: 54455
Gene name: FBXO42
Gene alias: Fbx42|KIAA1332
Gene description: F-box protein 42
Genbank accession: NM_018994
Immunogen: FBXO42 (NP_061867, 619 a.a. ~ 717 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR
Protein accession: NP_061867
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054455-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FBXO42 polyclonal antibody (A01) now

Add to cart