| Brand: | Abnova |
| Reference: | H00054414-B01P |
| Product name: | SIAE purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SIAE protein. |
| Gene id: | 54414 |
| Gene name: | SIAE |
| Gene alias: | CSE-C|LSE|MGC87009|YSG2 |
| Gene description: | sialic acid acetylesterase |
| Genbank accession: | NM_170601.3 |
| Immunogen: | SIAE (NP_733746.1, 1 a.a. ~ 523 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MVAPGLVLGLVLPLILWADRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAK |
| Protein accession: | NP_733746.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SIAE MaxPab polyclonal antibody. Western Blot analysis of SIAE expression in human colon. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | H2S protects lipopolysaccharide-induced inflammation by blocking NFκB transactivation in endothelial cells.Bourque C, Zhang Y, Fu M, Racine M, Greasley A, Pei Y, Wu L, Wang R, Yang G. Toxicol Appl Pharmacol. 2017 Nov 8;338:20-29. |