| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00054413-M02 |
| Product name: | NLGN3 monoclonal antibody (M02), clone 2A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NLGN3. |
| Clone: | 2A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54413 |
| Gene name: | NLGN3 |
| Gene alias: | ASPGX1|AUTSX1|HNL3|KIAA1480 |
| Gene description: | neuroligin 3 |
| Genbank accession: | NM_018977 |
| Immunogen: | NLGN3 (NP_061850, 590 a.a. ~ 689 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITRRPNGKTWSTKRPAISPAYSNENAQGSWNGDQDAGPLLVENPRDYSTELS |
| Protein accession: | NP_061850 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of NLGN3 expression in transfected 293T cell line by NLGN3 monoclonal antibody (M02), clone 2A6. Lane 1: NLGN3 transfected lysate(91.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |