CYTL1 polyclonal antibody (A02) View larger

CYTL1 polyclonal antibody (A02)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYTL1 polyclonal antibody (A02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CYTL1 polyclonal antibody (A02)

Brand: Abnova
Reference: H00054360-A02
Product name: CYTL1 polyclonal antibody (A02)
Product description: Mouse polyclonal antibody raised against a full-length recombinant CYTL1.
Gene id: 54360
Gene name: CYTL1
Gene alias: C17|C4orf4
Gene description: cytokine-like 1
Genbank accession: BC031391
Immunogen: CYTL1 (AAH31391, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTALPDRQR
Protein accession: AAH31391
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054360-A02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CYTL1 polyclonal antibody (A02) now

Add to cart