Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GDAP1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about GDAP1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00054332-A01 |
| Product name: | GDAP1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GDAP1. |
| Gene id: | 54332 |
| Gene name: | GDAP1 |
| Gene alias: | - |
| Gene description: | ganglioside-induced differentiation-associated protein 1 |
| Genbank accession: | NM_018972 |
| Immunogen: | GDAP1 (NP_061845, 158 a.a. ~ 257 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | TRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHR |
| Protein accession: | NP_061845 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GDAP1 polyclonal antibody (A01), Lot # 060613JCS1 Western Blot analysis of GDAP1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Mitochondrial complex I deficiency in GDAP1-related autosomal dominant Charcot-Marie-Tooth disease (CMT2K).Cassereau J, Chevrollier A, Gueguen N, Malinge MC, Letournel F, Nicolas G, Richard L, Ferre M, Verny C, Dubas F, Procaccio V, Amati-Bonneau P, Bonneau D, Reynier P. Neurogenetics. 2009 Apr;10(2):145-50. Epub 2008 Dec 17. |