No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00054331-M03 |
| Product name: | GNG2 monoclonal antibody (M03), clone 4C8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GNG2. |
| Clone: | 4C8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 54331 |
| Gene name: | GNG2 |
| Gene alias: | - |
| Gene description: | guanine nucleotide binding protein (G protein), gamma 2 |
| Genbank accession: | BC020774 |
| Immunogen: | GNG2 (AAH20774, 1 a.a. ~ 71 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL |
| Protein accession: | AAH20774 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of GNG2 expression in transfected 293T cell line by GNG2 monoclonal antibody (M03), clone 4C8. Lane 1: GNG2 transfected lysate(7.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |