Brand: | Abnova |
Reference: | H00054165-D01P |
Product name: | DCUN1D1 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human DCUN1D1 protein. |
Gene id: | 54165 |
Gene name: | DCUN1D1 |
Gene alias: | DCUN1L1|RP42|SCCRO|SCRO|Tes3 |
Gene description: | DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) |
Genbank accession: | NM_020640.2 |
Immunogen: | DCUN1D1 (NP_065691.2, 1 a.a. ~ 259 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV |
Protein accession: | NP_065691.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | DCUN1D1 MaxPab rabbit polyclonal antibody. Western Blot analysis of DCUN1D1 expression in mouse liver. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |