Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00054108-M11 |
Product name: | CHRAC1 monoclonal antibody (M11), clone 4E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHRAC1. |
Clone: | 4E7 |
Isotype: | IgG2a Kappa |
Gene id: | 54108 |
Gene name: | CHRAC1 |
Gene alias: | CHARC1|CHARC15|CHRAC15|YCL1 |
Gene description: | chromatin accessibility complex 1 |
Genbank accession: | NM_017444 |
Immunogen: | CHRAC1 (NP_059140, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPK |
Protein accession: | NP_059140 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CHRAC1 expression in transfected 293T cell line by CHRAC1 monoclonal antibody (M11), clone 4E7. Lane 1: CHRAC1 transfected lysate(14.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |