Cart 27 Product Products 11 388,00 € (empty)
No products
To be determined Shipping
11 388,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 27 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 11 388,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 11 388,00 €
Data sheet of CHRAC1 monoclonal antibody (M05), clone 4B8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about CHRAC1 monoclonal antibody (M05), clone 4B8
| Brand: | Abnova |
| Reference: | H00054108-M05 |
| Product name: | CHRAC1 monoclonal antibody (M05), clone 4B8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CHRAC1. |
| Clone: | 4B8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54108 |
| Gene name: | CHRAC1 |
| Gene alias: | CHARC1|CHARC15|CHRAC15|YCL1 |
| Gene description: | chromatin accessibility complex 1 |
| Genbank accession: | BC015891 |
| Immunogen: | CHRAC1 (AAH15891, 1 a.a. ~ 131 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS |
| Protein accession: | AAH15891 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.15 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CHRAC1 expression in transfected 293T cell line by CHRAC1 monoclonal antibody (M05), clone 4B8. Lane 1: CHRAC1 transfected lysate(14.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |