Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00054107-B01 |
Product name: | POLE3 MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human POLE3 protein. |
Gene id: | 54107 |
Gene name: | POLE3 |
Gene alias: | CHARAC17|CHRAC17|YBL1|p17 |
Gene description: | polymerase (DNA directed), epsilon 3 (p17 subunit) |
Genbank accession: | BC003166 |
Immunogen: | POLE3 (AAH03166, 1 a.a. ~ 147 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN |
Protein accession: | AAH03166 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of POLE3 expression in transfected 293T cell line (H00054107-T01) by POLE3 MaxPab polyclonal antibody. Lane 1: POLE3 transfected lysate(16.28 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |