| Brand: | Abnova |
| Reference: | H00054106-M02 |
| Product name: | TLR9 monoclonal antibody (M02), clone 1F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TLR9. |
| Clone: | 1F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54106 |
| Gene name: | TLR9 |
| Gene alias: | CD289 |
| Gene description: | toll-like receptor 9 |
| Genbank accession: | BC032713 |
| Immunogen: | TLR9 (AAH32713, 99 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVP |
| Protein accession: | AAH32713 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TLR9 monoclonal antibody (M02), clone 1F4 Western Blot analysis of TLR9 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |