No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00054101-M04 |
Product name: | RIPK4 monoclonal antibody (M04), clone 4H5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RIPK4. |
Clone: | 4H5 |
Isotype: | IgG3 Kappa |
Gene id: | 54101 |
Gene name: | RIPK4 |
Gene alias: | ANKK2|ANKRD3|DIK|MGC129992|MGC129993|PKK|RIP4 |
Gene description: | receptor-interacting serine-threonine kinase 4 |
Genbank accession: | NM_020639 |
Immunogen: | RIPK4 (NP_065690, 675 a.a. ~ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT |
Protein accession: | NP_065690 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | RIPK4 monoclonal antibody (M04), clone 4H5 Western Blot analysis of RIPK4 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |