No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00054097-B02P |
Product name: | FAM3B purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human FAM3B protein. |
Gene id: | 54097 |
Gene name: | FAM3B |
Gene alias: | 2-21|C21orf11|C21orf76|ORF9|PANDER|PRED44 |
Gene description: | family with sequence similarity 3, member B |
Genbank accession: | NM_058186 |
Immunogen: | FAM3B (NP_478066.3, 1 a.a. ~ 235 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS |
Protein accession: | NP_478066.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FAM3B expression in transfected 293T cell line (H00054097-T04) by FAM3B MaxPab polyclonal antibody. Lane 1: FAM3B transfected lysate(25.85 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |