Brand: | Abnova |
Reference: | H00053947-M08A |
Product name: | A4GALT monoclonal antibody (M08A), clone 3E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant A4GALT. |
Clone: | 3E12 |
Isotype: | IgG2a Kappa |
Gene id: | 53947 |
Gene name: | A4GALT |
Gene alias: | A14GALT|A4GALT1|P1|PK |
Gene description: | alpha 1,4-galactosyltransferase |
Genbank accession: | NM_017436 |
Immunogen: | A4GALT (NP_059132, 254 a.a. ~ 353 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL |
Protein accession: | NP_059132 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |