A4GALT monoclonal antibody (M08A), clone 3E12 View larger

A4GALT monoclonal antibody (M08A), clone 3E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of A4GALT monoclonal antibody (M08A), clone 3E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about A4GALT monoclonal antibody (M08A), clone 3E12

Brand: Abnova
Reference: H00053947-M08A
Product name: A4GALT monoclonal antibody (M08A), clone 3E12
Product description: Mouse monoclonal antibody raised against a partial recombinant A4GALT.
Clone: 3E12
Isotype: IgG2a Kappa
Gene id: 53947
Gene name: A4GALT
Gene alias: A14GALT|A4GALT1|P1|PK
Gene description: alpha 1,4-galactosyltransferase
Genbank accession: NM_017436
Immunogen: A4GALT (NP_059132, 254 a.a. ~ 353 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL
Protein accession: NP_059132
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy A4GALT monoclonal antibody (M08A), clone 3E12 now

Add to cart