Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BCL11A monoclonal antibody (M03), clone 3D9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about BCL11A monoclonal antibody (M03), clone 3D9
| Brand: | Abnova |
| Reference: | H00053335-M03 |
| Product name: | BCL11A monoclonal antibody (M03), clone 3D9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BCL11A. |
| Clone: | 3D9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 53335 |
| Gene name: | BCL11A |
| Gene alias: | BCL11A-L|BCL11A-S|BCL11A-XL|CTIP1|EVI9|FLJ10173|FLJ34997|HBFQTL5|KIAA1809|ZNF856 |
| Gene description: | B-cell CLL/lymphoma 11A (zinc finger protein) |
| Genbank accession: | NM_018014 |
| Immunogen: | BCL11A (NP_060484, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS |
| Protein accession: | NP_060484 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of BCL11A expression in transfected 293T cell line by BCL11A monoclonal antibody (M03), clone 3D9. Lane 1: BCL11A transfected lysate(26.865 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |