SIX4 monoclonal antibody (M09), clone 7E2 View larger

SIX4 monoclonal antibody (M09), clone 7E2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SIX4 monoclonal antibody (M09), clone 7E2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about SIX4 monoclonal antibody (M09), clone 7E2

Brand: Abnova
Reference: H00051804-M09
Product name: SIX4 monoclonal antibody (M09), clone 7E2
Product description: Mouse monoclonal antibody raised against a partial recombinant SIX4.
Clone: 7E2
Isotype: IgG1 Kappa
Gene id: 51804
Gene name: SIX4
Gene alias: AREC3|MGC119450|MGC119452|MGC119453
Gene description: SIX homeobox 4
Genbank accession: NM_017420
Immunogen: SIX4 (NP_059116, 672 a.a. ~ 780 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQDFVQEHRLVLQSVANMKENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD
Protein accession: NP_059116
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051804-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051804-M09-1-25-1.jpg
Application image note: SIX4 monoclonal antibody (M09), clone 7E2 Western Blot analysis of SIX4 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SIX4 monoclonal antibody (M09), clone 7E2 now

Add to cart