| Brand: | Abnova |
| Reference: | H00051804-M07 |
| Product name: | SIX4 monoclonal antibody (M07), clone 5E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SIX4. |
| Clone: | 5E1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 51804 |
| Gene name: | SIX4 |
| Gene alias: | AREC3|MGC119450|MGC119452|MGC119453 |
| Gene description: | SIX homeobox 4 |
| Genbank accession: | NM_017420 |
| Immunogen: | SIX4 (NP_059116, 672 a.a. ~ 780 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQDFVQEHRLVLQSVANMKENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD |
| Protein accession: | NP_059116 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SIX4 monoclonal antibody (M07), clone 5E1 Western Blot analysis of SIX4 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Specificity and prognostic validation of a polyclonal antibody to detect Six1 homeoprotein in ovarian cancer.Qamar L, Deitsch E, Patrick AN, Post MD, Spillman MA, Iwanaga R, Thorburn A, Ford HL, Behbakht K. Gynecol Oncol. 2012 Feb 12. [Epub ahead of print] |