Cart 33 Product Products 12 792,60 € (empty)
No products
To be determined Shipping
12 792,60 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 33 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 12 792,60 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 12 792,60 €
Data sheet of ZAK monoclonal antibody (M03), clone 3G5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,ELISA,WB-Re |
More info about ZAK monoclonal antibody (M03), clone 3G5
| Brand: | Abnova |
| Reference: | H00051776-M03 |
| Product name: | ZAK monoclonal antibody (M03), clone 3G5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZAK. |
| Clone: | 3G5 |
| Isotype: | IgG3 Lambda |
| Gene id: | 51776 |
| Gene name: | ZAK |
| Gene alias: | AZK|MLK7|MLT|MLTK|MRK|mlklak |
| Gene description: | sterile alpha motif and leucine zipper containing kinase AZK |
| Genbank accession: | BC001401 |
| Immunogen: | ZAK (AAH01401, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY |
| Protein accession: | AAH01401 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ZAK on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | AKAP-LBC anchors a PKN-based signaling complex involved in alpha1-adrenergic receptor-induced p38 activation.Cariolato L, Cavin S, Diviani D. J Biol Chem. 2011 Jan 11. [Epub ahead of print] |