Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HBXAP monoclonal antibody (M05), clone 3E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about HBXAP monoclonal antibody (M05), clone 3E6
| Brand: | Abnova |
| Reference: | H00051773-M05 |
| Product name: | HBXAP monoclonal antibody (M05), clone 3E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HBXAP. |
| Clone: | 3E6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51773 |
| Gene name: | RSF1 |
| Gene alias: | HBXAP|RSF-1|XAP8|p325 |
| Gene description: | remodeling and spacing factor 1 |
| Genbank accession: | NM_016578 |
| Immunogen: | HBXAP (NP_057662.3, 1343 a.a. ~ 1441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL |
| Protein accession: | NP_057662.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HBXAP is approximately 0.1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | HBxAPα/Rsf-1-mediated HBx-hBubR1 interactions regulate the mitotic spindle checkpoint and chromosome instability.Chae S, Ji JH, Kwon S, Lee HS, Lim J, Kang D, Lee C, Cho H Carcinogenesis. 2013 Mar 27. |