No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00051765-M02 |
Product name: | RP6-213H19.1 monoclonal antibody (M02), clone 7H4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RP6-213H19.1. |
Clone: | 7H4 |
Isotype: | IgG2a Kappa |
Gene id: | 51765 |
Gene name: | RP6-213H19.1 |
Gene alias: | MASK|MST4 |
Gene description: | serine/threonine protein kinase MST4 |
Genbank accession: | NM_016542 |
Immunogen: | RP6-213H19.1 (NP_057626, 331 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADES |
Protein accession: | NP_057626 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.09 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | RP6-213H19 1 monoclonal antibody (M02), clone 7H4 Western Blot analysis of RP6-213H19 1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |