RP6-213H19.1 MaxPab rabbit polyclonal antibody (D01) View larger

RP6-213H19.1 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RP6-213H19.1 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about RP6-213H19.1 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00051765-D01
Product name: RP6-213H19.1 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human RP6-213H19.1 protein.
Gene id: 51765
Gene name: RP6-213H19.1
Gene alias: MASK|MST4
Gene description: serine/threonine protein kinase MST4
Genbank accession: NM_016542.3
Immunogen: RP6-213H19.1 (NP_057626.2, 1 a.a. ~ 416 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP
Protein accession: NP_057626.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00051765-D01-13-15-1.jpg
Application image note: Western Blot analysis of RP6-213H19.1 expression in transfected 293T cell line (H00051765-T02) by RP6-213H19.1 MaxPab polyclonal antibody.

Lane 1: RP6-213H19.1 transfected lysate(46.5 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy RP6-213H19.1 MaxPab rabbit polyclonal antibody (D01) now

Add to cart