No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00051755-M02A |
Product name: | CRKRS monoclonal antibody (M02A), clone 2F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CRKRS. |
Clone: | 2F6 |
Isotype: | IgG1 Kappa |
Gene id: | 51755 |
Gene name: | CRKRS |
Gene alias: | CRK7|CRKR|KIAA0904 |
Gene description: | Cdc2-related kinase, arginine/serine-rich |
Genbank accession: | NM_016507 |
Immunogen: | CRKRS (NP_057591, 1281 a.a. ~ 1380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL |
Protein accession: | NP_057591 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | CRKRS monoclonal antibody (M02A), clone 2F6 Western Blot analysis of CRKRS expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |