| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00051754-B01 |
| Product name: | C9orf127 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human C9orf127 protein. |
| Gene id: | 51754 |
| Gene name: | C9orf127 |
| Gene alias: | MGC120460|NAG-5|NGX6|RP11-112J3.10 |
| Gene description: | chromosome 9 open reading frame 127 |
| Genbank accession: | BC041377.1 |
| Immunogen: | C9orf127 (AAH41377.1, 1 a.a. ~ 257 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MWRPHFHTCPPQSSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCILSLGACAWWWVTVCISTTFSEGLGMSVPSLCLLQTETAVLPKLSCIDNGHFCKTHWSK |
| Protein accession: | AAH41377.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of C9orf127 expression in transfected 293T cell line (H00051754-T01) by C9orf127 MaxPab polyclonal antibody. Lane 1: C9orf127 transfected lysate(28.27 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,IF,WB-Tr |
| Shipping condition: | Dry Ice |