Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CROP polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about CROP polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00051747-A01 |
| Product name: | CROP polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CROP. |
| Gene id: | 51747 |
| Gene name: | CROP |
| Gene alias: | LUC7A|OA48-18 |
| Gene description: | cisplatin resistance-associated overexpressed protein |
| Genbank accession: | NM_006107 |
| Immunogen: | CROP (NP_006098, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALS |
| Protein accession: | NP_006098 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CROP polyclonal antibody (A01), Lot # 050928JC01 Western Blot analysis of CROP expression in Y-79 ( Cat # L042V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Novel Splicing Factor RBM25 Modulates Bcl-x Pre-mRNA 5' Splice Site Selection.Zhou A, Ou AC, Cho A, Benz EJ Jr, Huang SC. Mol Cell Biol. 2008 Oct;28(19):5924-36. Epub 2008 Jul 28. |