| Brand: | Abnova |
| Reference: | H00051738-M13 |
| Product name: | GHRL monoclonal antibody (M13), clone 3G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GHRL. |
| Clone: | 3G3 |
| Isotype: | IgG |
| Gene id: | 51738 |
| Gene name: | GHRL |
| Gene alias: | MTLRP|obestatin |
| Gene description: | ghrelin/obestatin prepropeptide |
| Genbank accession: | NM_016362 |
| Immunogen: | GHRL (NP_057446, 24 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK |
| Protein accession: | NP_057446 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |