Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 682,92 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 682,92 €
Data sheet of GHRL monoclonal antibody (M01), clone 2F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about GHRL monoclonal antibody (M01), clone 2F4
| Brand: | Abnova |
| Reference: | H00051738-M01 |
| Product name: | GHRL monoclonal antibody (M01), clone 2F4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GHRL. |
| Clone: | 2F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51738 |
| Gene name: | GHRL |
| Gene alias: | MTLRP|obestatin |
| Gene description: | ghrelin/obestatin prepropeptide |
| Genbank accession: | BC025791 |
| Immunogen: | GHRL (AAH25791.1, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK |
| Protein accession: | AAH25791.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GHRL monoclonal antibody (M01), clone 2F4. Western Blot analysis of GHRL expression in HeLa. |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Mapping of Ghrelin Gene Expression and Cell Distribution in the Stomach of Morbidly Obese Patients-a Possible Guide for Efficient Sleeve Gastrectomy Construction.Goitein D, Lederfein D, Tzioni R, Berkenstadt H, Venturero M, Rubin M. Obes Surg. 2012 Jan 10. [Epub ahead of print] |