| Brand: | Abnova |
| Reference: | H00051735-M01 |
| Product name: | RAPGEF6 monoclonal antibody (M01), clone 2C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAPGEF6. |
| Clone: | 2C5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51735 |
| Gene name: | RAPGEF6 |
| Gene alias: | DKFZp667N084|DKFZp686I15116|KIA001LB|PDZ-GEF2|PDZGEF2|RA-GEF-2|RAGEF2 |
| Gene description: | Rap guanine nucleotide exchange factor (GEF) 6 |
| Genbank accession: | NM_016340 |
| Immunogen: | RAPGEF6 (NP_057424, 1012 a.a. ~ 1110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LFPVVKKDMTFLHEGNDSKVDGLVNFEKLRMISKEIRQVVRMTSANMDPAMMFRQRSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARK |
| Protein accession: | NP_057424 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RAPGEF6 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Critical function of RA-GEF-2/Rapgef6, a guanine nucleotide exchange factor for Rap1, in mouse spermatogenesis.Okada K, Miyake H, Yamaguchi K, Chiba K, Maeta K, Bilasy SE, Edamatsu H, Kataoka T, Fujisawa M Biochem Biophys Res Commun. 2014 Jan 31. pii: S0006-291X(14)00184-3. doi: 10.1016/j.bbrc.2014.01.149. |