No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00051696-A01 |
| Product name: | HECA polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HECA. |
| Gene id: | 51696 |
| Gene name: | HECA |
| Gene alias: | HDC|HDCL|HHDC|dJ225E12.1 |
| Gene description: | headcase homolog (Drosophila) |
| Genbank accession: | NM_016217 |
| Immunogen: | HECA (NP_057301, 434 a.a. ~ 543 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | CHLQGRLMHLYAVCVDCLEGVHKIICIKCKSRWDGSWHQLGTMYTYDILAASPCCQARLNCKHCGKPVIDVRIGMQYFSEYSNVQQCPHCGNLDYHFVKPFSSFKVLEAY |
| Protein accession: | NP_057301 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | ![]() |
| Application image note: | HECA polyclonal antibody (A01), Lot # URB7060404QCS1 Western Blot analysis of HECA expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The human homolog of the Drosophila headcase protein slows down cell division of head and neck cancer cells.Dowejko A, Bauer RJ, Muller-Richter UD, Reichert TE. Carcinogenesis. 2009 Oct;30(10):1678-85. Epub 2009 Jul 30. |