No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,PLA-Ce |
Brand: | Abnova |
Reference: | H00051684-M01 |
Product name: | SUFU monoclonal antibody (M01), clone 1B2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SUFU. |
Clone: | 1B2 |
Isotype: | IgG2a Kappa |
Gene id: | 51684 |
Gene name: | SUFU |
Gene alias: | PRO1280|SUFUH|SUFUXL |
Gene description: | suppressor of fused homolog (Drosophila) |
Genbank accession: | BC013291 |
Immunogen: | SUFU (AAH13291, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EDPQMQPVQTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSR |
Protein accession: | AAH13291 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged SUFU is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,PLA-Ce |
Shipping condition: | Dry Ice |