View larger

TPPP3 purified MaxPab mouse polyclonal antibody (B02P)

Reference:

Condition: New product

Data sheet of TPPP3 purified MaxPab mouse polyclonal antibody (B02P)

Brand:	Abnova
Reference:	H00051673-B02P
Product name:	TPPP3 purified MaxPab mouse polyclonal antibody (B02P)
Product description:	Mouse polyclonal antibody raised against a full-length human TPPP3 protein.
Gene id:	51673
Gene name:	TPPP3
Gene alias:	CGI-38\|p20\|p25gamma
Gene description:	tubulin polymerization-promoting protein family member 3
Genbank accession:	NM_015964
Immunogen:	TPPP3 (NP_057048.2, 1 a.a. ~ 176 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
Protein accession:	NP_057048.2
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of TPPP3 expression in transfected 293T cell line (H00051673-T02) by TPPP3 MaxPab polyclonal antibody. Lane 1: TPPP3 transfected lysate(19.00 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice