| Brand: | Abnova |
| Reference: | H00051666-M01 |
| Product name: | ASB4 monoclonal antibody (M01), clone 2G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ASB4. |
| Clone: | 2G11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51666 |
| Gene name: | ASB4 |
| Gene alias: | ASB-4|MGC142039|MGC142041 |
| Gene description: | ankyrin repeat and SOCS box-containing 4 |
| Genbank accession: | NM_016116 |
| Immunogen: | ASB4 (NP_057200, 295 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VTSVRPAAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRWNTKWRRAIPDDDLEKYWDFYHSLFTVCCNSPRTLMHLSRCAIRRTLHNRCHRA |
| Protein accession: | NP_057200 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |