Cart 6 Product Products 2 168,00 € (empty)
No products
To be determined Shipping
2 168,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 168,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 168,00 €
Data sheet of TRIM33 monoclonal antibody (M02), clone 6F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA |
More info about TRIM33 monoclonal antibody (M02), clone 6F4
| Brand: | Abnova |
| Reference: | H00051592-M02 |
| Product name: | TRIM33 monoclonal antibody (M02), clone 6F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM33. |
| Clone: | 6F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51592 |
| Gene name: | TRIM33 |
| Gene alias: | FLJ32925|PTC7|RFG7|TF1G|TIF1G|TIF1GAMMA|TIFGAMMA |
| Gene description: | tripartite motif-containing 33 |
| Genbank accession: | NM_015906 |
| Immunogen: | TRIM33 (NP_056990, 1006 a.a. ~ 1105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS |
| Protein accession: | NP_056990 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to TRIM33 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |