No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00051592-M01 |
Product name: | TRIM33 monoclonal antibody (M01), clone 6D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM33. |
Clone: | 6D1 |
Isotype: | IgG1 Kappa |
Gene id: | 51592 |
Gene name: | TRIM33 |
Gene alias: | FLJ32925|PTC7|RFG7|TF1G|TIF1G|TIF1GAMMA|TIFGAMMA |
Gene description: | tripartite motif-containing 33 |
Genbank accession: | NM_015906 |
Immunogen: | TRIM33 (NP_056990, 1006 a.a. ~ 1105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS |
Protein accession: | NP_056990 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to TRIM33 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Tumour TIF1 mutations and loss of heterozygosity related to cancer-associated myositis.Pinal-Fernandez I, Ferrer-Fabregas B, Trallero-Araguas E, Balada E, Martinez MA, Milisenda JC, Aparicio-Espanol G, Labrador-Horrillo M, Garcia-Patos V, Grau-Junyent JM, Selva-OCallaghan A. Rheumatology (Oxford). 2017 Nov 14. [Epub ahead of print] |