No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA |
Brand: | Abnova |
Reference: | H00051573-M04 |
Product name: | MIR16 monoclonal antibody (M04), clone 2H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MIR16. |
Clone: | 2H6 |
Isotype: | IgG2a Kappa |
Gene id: | 51573 |
Gene name: | GDE1 |
Gene alias: | 363E6.2|MIR16 |
Gene description: | glycerophosphodiester phosphodiesterase 1 |
Genbank accession: | NM_016641 |
Immunogen: | MIR16 (NP_057725, 31 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ACLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLN |
Protein accession: | NP_057725 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to GDE1 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA |
Shipping condition: | Dry Ice |