Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL23A (Human) Recombinant Protein (P01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about IL23A (Human) Recombinant Protein (P01)
| Brand: | Abnova |
| Reference: | H00051561-P01 |
| Product name: | IL23A (Human) Recombinant Protein (P01) |
| Product description: | Human IL23A full-length ORF ( NP_057668.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 51561 |
| Gene name: | IL23A |
| Gene alias: | IL-23|IL-23A|IL23P19|MGC79388|P19|SGRF |
| Gene description: | interleukin 23, alpha subunit p19 |
| Genbank accession: | NM_016584.2 |
| Immunogen sequence/protein sequence: | MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP |
| Protein accession: | NP_057668.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Damage effect of interleukin (IL)-23 on oxygen-glucose-deprived cells of the neurovascular unit via IL-23 receptor.Wang M, Zhong D, Zheng Y, Li H, Chen H, Ma S, Sun Y, Yan W, Li G. Neuroscience. 2015 Mar 19;289:406-16. |