Cart 12 Product Products 4 325,06 € (empty)
No products
To be determined Shipping
4 325,06 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 12 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 325,06 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 325,06 €
Data sheet of IL23A monoclonal antibody (M01), clone 4C8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about IL23A monoclonal antibody (M01), clone 4C8
| Brand: | Abnova |
| Reference: | H00051561-M01 |
| Product name: | IL23A monoclonal antibody (M01), clone 4C8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant IL23A. |
| Clone: | 4C8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51561 |
| Gene name: | IL23A |
| Gene alias: | IL-23|IL-23A|IL23P19|MGC79388|P19|SGRF |
| Gene description: | interleukin 23, alpha subunit p19 |
| Genbank accession: | NM_016584.2 |
| Immunogen: | IL23A (NP_057668.1, 1 a.a. ~ 189 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP |
| Protein accession: | NP_057668.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (47.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IL23A monoclonal antibody (M01), clone 4C8. Western Blot analysis of IL23A expression in human lung cancer. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |