SCLY polyclonal antibody (A01) View larger

SCLY polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCLY polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SCLY polyclonal antibody (A01)

Brand: Abnova
Reference: H00051540-A01
Product name: SCLY polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SCLY.
Gene id: 51540
Gene name: SCLY
Gene alias: SCL
Gene description: selenocysteine lyase
Genbank accession: NM_016510
Immunogen: SCLY (NP_057594, 346 a.a. ~ 444 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: NSQFPGTQRLPNTCNFSIRGPRLQGHVVLAQCRVLMASVGAACHSDHGDQPSPVLLSYGVPFDVARNALRLSVGRSTTRAEVDLVVQDLKQAVAQLEDQ
Protein accession: NP_057594
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051540-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051540-A01-1-15-1.jpg
Application image note: SCLY polyclonal antibody (A01), Lot # 051220JC01 Western Blot analysis of SCLY expression in 293 ( Cat # L026V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SCLY polyclonal antibody (A01) now

Add to cart