Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ANAPC11 monoclonal antibody (M01), clone 1B4-1A4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about ANAPC11 monoclonal antibody (M01), clone 1B4-1A4
| Brand: | Abnova |
| Reference: | H00051529-M01 |
| Product name: | ANAPC11 monoclonal antibody (M01), clone 1B4-1A4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ANAPC11. |
| Clone: | 1B4-1A4 |
| Isotype: | IgG1 kappa |
| Gene id: | 51529 |
| Gene name: | ANAPC11 |
| Gene alias: | APC11|Apc11p|HSPC214|MGC882 |
| Gene description: | anaphase promoting complex subunit 11 |
| Genbank accession: | BC000607 |
| Immunogen: | ANAPC11 (AAH00607, 1 a.a. ~ 54 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE |
| Protein accession: | AAH00607 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.68 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ANAPC11 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Integrated analysis highlights APC11 protein expression as a likely new independent predictive marker for colorectal cancer.Drouet Y, Treilleux I, Viari A, Leon S, Devouassoux-Shisheboran M, Voirin N, de la Fouchardiere C, Manship B, Puisieux A, Lasset C, Moyret-Lalle C. Sci Rep. 2018 May 9;8(1):7386. |