Cart 88 Product Products 29 071,88 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-El...259,07 € -
-
-
-
-
1 x EphA3...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x C7...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x EphA7...259,07 € -
-
-
-
1 x Phospho-Ep...259,07 € -
-
-
-
-
-
-
-
-
-
-
1 x Emx1...259,07 € -
-
-
-
-
No products
To be determined Shipping
29 071,88 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 88 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 29 071,88 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 29 071,88 €
Data sheet of ETV7 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about ETV7 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00051513-D01P |
| Product name: | ETV7 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ETV7 protein. |
| Gene id: | 51513 |
| Gene name: | ETV7 |
| Gene alias: | TEL-2|TEL2|TELB |
| Gene description: | ets variant 7 |
| Genbank accession: | NM_016135.2 |
| Immunogen: | ETV7 (NP_057219.1, 1 a.a. ~ 341 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP |
| Protein accession: | NP_057219.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ETV7 expression in transfected 293T cell line (H00051513-T02) by ETV7 MaxPab polyclonal antibody. Lane 1: ETV7 transfected lysate(39.00 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |