GTSE1 polyclonal antibody (A01) View larger

GTSE1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GTSE1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about GTSE1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00051512-A01
Product name: GTSE1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GTSE1.
Gene id: 51512
Gene name: GTSE1
Gene alias: B99
Gene description: G-2 and S-phase expressed 1
Genbank accession: NM_016426
Immunogen: GTSE1 (NP_057510, 621 a.a. ~ 720 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PSEALLVDIKLEPLAVTPDAASQPLIDLPLIDFCDTPEAHVAVGSESRPLIDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF
Protein accession: NP_057510
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051512-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051512-A01-1-35-1.jpg
Application image note: GTSE1 polyclonal antibody (A01), Lot # 050712JC01 Western Blot analysis of GTSE1 expression in Y-79 ( Cat # L042V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GTSE1 polyclonal antibody (A01) now

Add to cart