HSPC152 purified MaxPab mouse polyclonal antibody (B01P) View larger

HSPC152 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSPC152 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about HSPC152 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00051504-B01P
Product name: HSPC152 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human HSPC152 protein.
Gene id: 51504
Gene name: HSPC152
Gene alias: -
Gene description: hypothetical protein HSPC152
Genbank accession: NM_016404.1
Immunogen: HSPC152 (NP_057488.1, 1 a.a. ~ 125 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Protein accession: NP_057488.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051504-B01P-13-15-1.jpg
Application image note: Western Blot analysis of HSPC152 expression in transfected 293T cell line (H00051504-T01) by HSPC152 MaxPab polyclonal antibody.

Lane 1: HSPC152 transfected lysate(13.75 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HSPC152 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart