View larger

HSPC111 monoclonal antibody (M01), clone 1G4

Reference:

Condition: New product

Data sheet of HSPC111 monoclonal antibody (M01), clone 1G4

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Host species	Mouse
Applications	WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

Brand:	Abnova
Reference:	H00051491-M01
Product name:	HSPC111 monoclonal antibody (M01), clone 1G4
Product description:	Mouse monoclonal antibody raised against a full length recombinant HSPC111.
Clone:	1G4
Isotype:	IgG1 Kappa
Gene id:	51491
Gene name:	NOP16
Gene alias:	HSPC111\|HSPC185
Gene description:	NOP16 nucleolar protein homolog (yeast)
Genbank accession:	BC040106
Immunogen:	HSPC111 (AAH40106, 1 a.a. ~ 178 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE
Protein accession:	AAH40106
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (45.32 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunoperoxidase of monoclonal antibody to HSPC111 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Applications:	WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice