Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NOP16 MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,IF,WB-Tr,IP |
More info about NOP16 MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00051491-D01 |
| Product name: | NOP16 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human NOP16 protein. |
| Gene id: | 51491 |
| Gene name: | NOP16 |
| Gene alias: | HSPC111|HSPC185 |
| Gene description: | NOP16 nucleolar protein homolog (yeast) |
| Genbank accession: | BC040106 |
| Immunogen: | NOP16 (AAH40106.1, 1 a.a. ~ 178 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE |
| Protein accession: | AAH40106.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | HSPC111 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSPC111 expression in human liver. |
| Applications: | WB-Ce,WB-Ti,IF,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Molecular characterizations of Nop16 in murine mammary tumors with varying levels of c-Myc.Kundel DW, Stromquist E, Greene AL, Zhdankin O, Regal RR, Rose-Hellekant TA. Transgenic Res. 2011 Aug 24. [Epub ahead of print] |