No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00051481-B01P |
Product name: | VCX3A purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human VCX3A protein. |
Gene id: | 51481 |
Gene name: | VCX3A |
Gene alias: | MGC118976|MGC125730|MGC125796|VCX-8r|VCX-A|VCX3|VCX8R|VCXA |
Gene description: | variable charge, X-linked 3A |
Genbank accession: | BC098149.1 |
Immunogen: | VCX3A (AAH98149.1, 1 a.a. ~ 166 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEELPSM |
Protein accession: | AAH98149.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of VCX3A expression in transfected 293T cell line (H00051481-T01) by VCX3A MaxPab polyclonal antibody. Lane 1: VCX3A transfected lysate(18.26 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |