No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00051478-M01 |
| Product name: | HSD17B7 monoclonal antibody (M01), clone 1G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HSD17B7. |
| Clone: | 1G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51478 |
| Gene name: | HSD17B7 |
| Gene alias: | MGC12523|MGC75018|PRAP|SDR37C1 |
| Gene description: | hydroxysteroid (17-beta) dehydrogenase 7 |
| Genbank accession: | NM_016371 |
| Immunogen: | HSD17B7 (NP_057455.1, 255 a.a. ~ 341 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL |
| Protein accession: | NP_057455.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.31 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged HSD17B7 is 0.3 ng/ml as a capture antibody. |
| Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |