No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00051460-M02 |
Product name: | SFMBT1 monoclonal antibody (M02), clone 2A1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SFMBT1. |
Clone: | 2A1 |
Isotype: | IgG2a Kappa |
Gene id: | 51460 |
Gene name: | SFMBT1 |
Gene alias: | DKFZp434L243|RU1|SFMBT |
Gene description: | Scm-like with four mbt domains 1 |
Genbank accession: | NM_016329 |
Immunogen: | SFMBT1 (NP_057413, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQ |
Protein accession: | NP_057413 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SFMBT1 expression in transfected 293T cell line by SFMBT1 monoclonal antibody (M02), clone 2A1. Lane 1: SFMBT1 transfected lysate(98.141 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |