Cart 54 Product Products 17 649,32 € (empty)
-
-
1 x 5-LO...259,07 € -
1 x PRP6...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x NGFR p75...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
17 649,32 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 54 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 17 649,32 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 17 649,32 €
Data sheet of SFMBT1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about SFMBT1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00051460-A01 |
| Product name: | SFMBT1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SFMBT1. |
| Gene id: | 51460 |
| Gene name: | SFMBT1 |
| Gene alias: | DKFZp434L243|RU1|SFMBT |
| Gene description: | Scm-like with four mbt domains 1 |
| Genbank accession: | NM_016329 |
| Immunogen: | SFMBT1 (NP_057413, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQ |
| Protein accession: | NP_057413 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SFMBT1 expression in transfected 293T cell line by SFMBT1 polyclonal antibody (A01). Lane1:SFMBT1 transfected lysate (Predicted MW: 98.1 KDa). Lane2:Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |