No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00051460-A01 |
Product name: | SFMBT1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SFMBT1. |
Gene id: | 51460 |
Gene name: | SFMBT1 |
Gene alias: | DKFZp434L243|RU1|SFMBT |
Gene description: | Scm-like with four mbt domains 1 |
Genbank accession: | NM_016329 |
Immunogen: | SFMBT1 (NP_057413, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | EGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQ |
Protein accession: | NP_057413 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SFMBT1 expression in transfected 293T cell line by SFMBT1 polyclonal antibody (A01). Lane1:SFMBT1 transfected lysate (Predicted MW: 98.1 KDa). Lane2:Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |