Product successfully added to your shopping cart
Quantity
Total
There are 5 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 975,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 975,00 €
Data sheet of RHCG monoclonal antibody (M06), clone 5A4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,ELISA,WB-Re |
More info about RHCG monoclonal antibody (M06), clone 5A4
| Brand: | Abnova |
| Reference: | H00051458-M06 |
| Product name: | RHCG monoclonal antibody (M06), clone 5A4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RHCG. |
| Clone: | 5A4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51458 |
| Gene name: | RHCG |
| Gene alias: | C15orf6|PDRC2|RHGK|SLC42A3 |
| Gene description: | Rh family, C glycoprotein |
| Genbank accession: | NM_016321 |
| Immunogen: | RHCG (NP_057405, 418 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP |
| Protein accession: | NP_057405 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RHCG on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Remodeling of the Fetal Collecting Duct Epithelium.Hiatt MJ, Ivanova L, Toran N, Tarantal AF, Matsell DG. Am J Pathol. 2010 Feb;176(2):630-7. Epub 2009 Dec 24. |