View larger

RHCG monoclonal antibody (M06), clone 5A4

Reference:

Condition: New product

Data sheet of RHCG monoclonal antibody (M06), clone 5A4

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human,Rat
Host species	Mouse
Applications	WB-Ce,IHC-P,ELISA,WB-Re

More info about RHCG monoclonal antibody (M06), clone 5A4

Brand:	Abnova
Reference:	H00051458-M06
Product name:	RHCG monoclonal antibody (M06), clone 5A4
Product description:	Mouse monoclonal antibody raised against a partial recombinant RHCG.
Clone:	5A4
Isotype:	IgG2a Kappa
Gene id:	51458
Gene name:	RHCG
Gene alias:	C15orf6\|PDRC2\|RHGK\|SLC42A3
Gene description:	Rh family, C glycoprotein
Genbank accession:	NM_016321
Immunogen:	RHCG (NP_057405, 418 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP
Protein accession:	NP_057405
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (32.56 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human,Rat
Application image:
Application image note:	Immunoperoxidase of monoclonal antibody to RHCG on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Applications:	WB-Ce,IHC-P,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Remodeling of the Fetal Collecting Duct Epithelium.Hiatt MJ, Ivanova L, Toran N, Tarantal AF, Matsell DG. Am J Pathol. 2010 Feb;176(2):630-7. Epub 2009 Dec 24.

Reviews

Be the first to write your review !

Buy RHCG monoclonal antibody (M06), clone 5A4 now

Add to cart