Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PRRX2 monoclonal antibody (M01), clone 4C9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PRRX2 monoclonal antibody (M01), clone 4C9
| Brand: | Abnova |
| Reference: | H00051450-M01 |
| Product name: | PRRX2 monoclonal antibody (M01), clone 4C9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PRRX2. |
| Clone: | 4C9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 51450 |
| Gene name: | PRRX2 |
| Gene alias: | MGC19843|PMX2|PRX2 |
| Gene description: | paired related homeobox 2 |
| Genbank accession: | NM_016307 |
| Immunogen: | PRRX2 (NP_057391.1, 151 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | WFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN |
| Protein accession: | NP_057391.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PRRX2 expression in transfected 293T cell line by PRRX2 monoclonal antibody (M01), clone 4C9. Lane 1: PRRX2 transfected lysate(27.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |