TRAPPC4 MaxPab mouse polyclonal antibody (B01) View larger

TRAPPC4 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRAPPC4 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about TRAPPC4 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00051399-B01
Product name: TRAPPC4 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human TRAPPC4 protein.
Gene id: 51399
Gene name: TRAPPC4
Gene alias: CGI-104|HSPC172|PTD009|SBDN|SYNBINDIN|TRS23
Gene description: trafficking protein particle complex 4
Genbank accession: NM_016146
Immunogen: TRAPPC4 (NP_057230, 1 a.a. ~ 219 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS
Protein accession: NP_057230
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051399-B01-13-15-1.jpg
Application image note: Western Blot analysis of TRAPPC4 expression in transfected 293T cell line (H00051399-T01) by TRAPPC4 MaxPab polyclonal antibody.

Lane 1: TRAPPC4 transfected lysate(24.09 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TRAPPC4 MaxPab mouse polyclonal antibody (B01) now

Add to cart